SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U6DDQ9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U6DDQ9
Domain Number 1 Region: 2-243
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.01e-95
Family Capz beta-1 subunit 0.000000000614
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U6DDQ9
Sequence length 243
Comment (tr|U6DDQ9|U6DDQ9_NEOVI) F-actin-capping protein subunit beta {ECO:0000313|EMBL:CCP80709.1} OX=452646 OS=Neovison vison (American mink) (Mustela vison). GN=CAPZB OC=Mustelinae; Neovison.
Sequence
MSDQQLDCALDLMRRLPPQQIEKNLSDLIDLVPSLCEDLLSSVDQPLKIARDKVVGKDYL
LCDYNRDGDSYRSPWSNKYDPPLEDGAMPSARLRKLEVEANNAFDQYRDLYFEGGVSSVY
LWDLDHGFAGVILIKKAGDGSKKIKGCWDSIHVVEVQEKSSGRTAHYKLTSTVMLWLQTN
KSGSGTMNLGGSLTRQMEKDETVSDCSPHIANIGRLVEDMENKIRSTLNEIYFGKTKDIV
NGL
Download sequence
Identical sequences M1EE99 U6DDQ9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]