SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U6K324 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U6K324
Domain Number 1 Region: 12-281
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.49e-26
Family Capz beta-1 subunit 0.00014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U6K324
Sequence length 520
Comment (tr|U6K324|U6K324_9EIME) F-actin capping protein beta subunit, putative {ECO:0000313|EMBL:CDJ30732.1} KW=Complete proteome; Reference proteome OX=44415 OS=Eimeria mitis. GN=EMH_0060950 OC=Eucoccidiorida; Eimeriorina; Eimeriidae; Eimeria.
Sequence
MSRYSGQQKEAAELAVSLVRLVSLDTINQSIDHAAALSPAAEEFLRGGSHALPQLLVDPL
VGKYFIACSCNKLSSSYRSPWTDTWLPPIPDAAKPAPHLRQLEQQFNAAYDAYRDAHYGG
GVSSVYAWPLQNQDGFVAAFLLLKEMPVDEAKLPFCFFFHRLEVTLTATNGYYRLSSSLL
LHLPSPAAAGGYSVAISRSFEQTQKVADPRAAAAAAAAPAAAAAAAAATSLASLHLDVGG
KIIEKAEKVLIAAATETQLARSAQIISDIRSPRGTDEELDPQYQQQQQQQKQQLQQHQHQ
QQQQQQQQQQQQTCLGCRRRGDSSSAAAAAAAAAAAADTAAAAAEETAAAAAEETETAVA
AAARTTAADQAPQQVLQQQQQQQLLLLLLLIFWLEAPAAAAATAAAAIAAAAVAIATAAV
AATPKAIAAEATAAAAAAATAATAAAAAAAAEASPHQPLVQSCCYLQVWLLTQQQQQQQQ
QQHQQQHQHQQQQQQQQQQQQQQQQQQQQFAVPLCFLRSG
Download sequence
Identical sequences U6K324
XP_013353297.1.45086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]