SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U6L6E2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U6L6E2
Domain Number 1 Region: 205-363
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.79e-25
Family Capz beta-1 subunit 0.00033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U6L6E2
Sequence length 548
Comment (tr|U6L6E2|U6L6E2_EIMTE) F-actin capping protein beta subunit, putative {ECO:0000313|EMBL:CDJ44159.1} KW=Complete proteome; Reference proteome OX=5802 OS=Eimeria tenella (Coccidian parasite). GN=ETH_00034850 OC=Eucoccidiorida; Eimeriorina; Eimeriidae; Eimeria.
Sequence
MALYSGQQKETLELAAALVRLGPLDAVNESLAHAAARDGPYGADTREELQQEEQQLLQQQ
QLNCCSSNSIAAAAATQLLQQQQLNCCSSNSIAAAATQLLQQQLNCRSSNSIAAAATQLL
QQQFHSCSSSSTAAAATLLLQQQHQLLLHPWQQQLQQQQQQQLQQQQQQQQQQQQQQQQQ
QQKLMPSALCPSIEGLLRDRCQGIPELVVDPAAGKYFIASYFNKLKNSFRSPWTDTWLPP
ISDASKPAPHLRQLEQQFNAAYNSYRDAHYGGGVSSVYAWPLQSQDGFAAAFLLLKEAPV
DEPLLPLCFFTHRLEVTLTATNAHYKLHSTLLLHLPAAASPETKGGFSAVLSKSLEQTQK
VVDARVAATTATGAPMGPLHLAVGGPLIEKAEAALLDAAAGSLLPRSGQPTLKRPRAAAI
PACSEAAAAAAAAAAAAGTQAVLSAVAAATAAAAAAAAAEQAAAVATAVAAEVAAAAVAA
EAAAVAAAAAASSSSPIKTITDKEAAAARIIRLKKAEGPPLGAPLMGGPLMGAPISEPHK
FKGPAVHL
Download sequence
Identical sequences U6L6E2
XP_013234908.1.50571

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]