SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U6NV33 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U6NV33
Domain Number 1 Region: 9-171
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.84e-47
Family Capz alpha-1 subunit 0.00000713
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) U6NV33
Sequence length 171
Comment (tr|U6NV33|U6NV33_HAECO) F-actin capping protein domain containing protein {ECO:0000313|EMBL:CDJ83023.1} KW=Complete proteome; Reference proteome OX=6289 OS=Haemonchus contortus (Barber pole worm). GN=HCOI_00362600 OC=Haemonchus.
Sequence
MTSEAAIPDSEKVRIVSDFLQHAPPGEFNEVFNAVRMLLNNDQLLKEGCAQAITKYNESQ
FAPVKLEGVEKQTLVTPFNDIGGGRYVDDASKKSFNNGRWRSEWKVPVGEGKSGSQELVG
KIKVQVHYYEDGNVQLFSEKECNVKIQISSDVEKTAKEIIQAIKDEEGKYQ
Download sequence
Identical sequences U6NV33

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]