SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U7QIR1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  U7QIR1
Domain Number 1 Region: 8-99
Classification Level Classification E-value
Superfamily PDZ domain-like 0.00000000000684
Family PDZ domain 0.1
Further Details:      
 
Domain Number 2 Region: 92-240
Classification Level Classification E-value
Superfamily Radical SAM enzymes 0.0000000000942
Family MoCo biosynthesis proteins 0.018
Further Details:      
 
Weak hits

Sequence:  U7QIR1
Domain Number - Region: 248-302
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0238
Family Capz alpha-1 subunit 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U7QIR1
Sequence length 443
Comment (tr|U7QIR1|U7QIR1_9CYAN) Uncharacterized protein {ECO:0000313|EMBL:ERT06950.1} KW=Complete proteome OX=1348334 OS=Lyngbya aestuarii BL J. GN=M595_3061 OC=Oscillatoriaceae; Lyngbya.
Sequence
MSNRSFRPAQITKVLPDSIADEMGFEPGDAIISINGQHPRDLIDYQFFCADEILELEVLD
SRGKVHQVEIEKDYDQDLGLEFETALFDGLIQCNNRCPFCFIDQQPPGKRETLYLKDDDY
RLSFLYGSYLTLTNLPPREWQRIAQMRLSPLYVSVHATEADVRVRLLKNSRAGEILKQLQ
WFQENRLQIHAQVVVCPGINDGQHLETTLQDLAGFHTGEIPTVASVAVVPVGLTRFRPPE
DELIPVTPEKATEVITQVQTIQEKLQQKYDKNCVWLADEWFLIARQPLPPTSHYQDYPQI
GNGVGSIRKFLQEFEIAIAKFPNHRQTPRRFTWVVGNAVEVAFAPVVERFNQISGLTVDM
IALCSQYWGQTITVTGLLTGQDLLQGLQGKNLGDCILLPSVMLKHEDTLFLDDMSVAELS
QQLQTPILPVTDVEALISKALND
Download sequence
Identical sequences U7QIR1
WP_023066849.1.70589

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]