SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for U9TA94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U9TA94
Domain Number - Region: 2-62
Classification Level Classification E-value
Superfamily Smp-1-like 0.0497
Family Smp-1-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) U9TA94
Sequence length 281
Comment (tr|U9TA94|U9TA94_RHIID) Very-long-chain 3-oxoacyl-CoA synthase {ECO:0000256|RuleBase:RU361115} KW=Complete proteome; Reference proteome OX=747089 OS=43194) (Arbuscular mycorrhizal fungus) (Glomus intraradices). GN=GLOINDRAFT_243266 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MNDTKNSIARVEEIFSIPYDTSRWDYSQFTNPYEFQWKVGITPFSNWQFVVGVWATYFVT
IVSLKYIMSFRAPFSMRYITAIHNLFLCIVSAVMCGYAIIDVIRRYQEHGIGECFCTSDS
SLAKGRISYVTYIYYLSKFDELFDTVILVLKKKSIIFLHWYHHAIVILMVWSWLEDSIMY
ASIGMIANTLVHVFMYYYYFSASLGRSVWFKKYITTGQIVQFTISFILAIPYLYFHFTNN
CQLGFVSFVFSMVCNGSFLILFIRFYKKAYKSGAGTKRKEM
Download sequence
Identical sequences A0A2I1DV69 U9TA94

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]