SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for U9UG06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  U9UG06
Domain Number - Region: 38-104
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0863
Family Capz beta-1 subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) U9UG06
Sequence length 427
Comment (tr|U9UG06|U9UG06_RHIID) Uncharacterized protein {ECO:0000313|EMBL:ESA18592.1} KW=Complete proteome; Reference proteome OX=747089 OS=43194) (Arbuscular mycorrhizal fungus) (Glomus intraradices). GN=GLOINDRAFT_20534 OC=Glomerales; Glomeraceae; Rhizophagus.
Sequence
MYFIVAIYKHNKLLQDDAIDIEENKNFEDLLSEVRVIQKLDMKLSFCKNFEPCQVKYILE
DLEDIEPDLVPHVNPLPILMVNSQRYCLPVAHKSSTRRDFLFNDILWILQQNSLGWTRGM
HETFGDKFINCLIIDLLWYLDPHHAKLKDRGCNLPNIILNLPEYKINSNYNRFYFTGKHK
KEQLSVVKLDGYVKEVESCVSQPWASAERWKQFVFSVLDLCHNARKYIKYLEEVNQSVKE
NHLSVDFIRNKIDNILIEIREKKESFDKKYDDISSILHNSDYYELISLDTYLSDDKRARY
DFILNLEVDSAFTLYRYYHGNYLGTLNFIWKLPYFDDRSKTKESQLILLANEMVPIFFTR
QMKKNVIEKYSLIAKLTPLIWNKLLQDLSGDSSSSSNELTKEMQDRIQTVLDLQDPEIIL
DLRVNYK
Download sequence
Identical sequences U9UG06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]