SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V3PW23 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V3PW23
Domain Number 1 Region: 27-188
Classification Level Classification E-value
Superfamily MtlR-like 5.36e-58
Family MtlR-like 0.0000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V3PW23
Sequence length 196
Comment (tr|V3PW23|V3PW23_9ENTR) Mannitol operon repressor {ECO:0000313|EMBL:ESN15431.1} KW=Complete proteome OX=1329828 OS=Enterobacter sp. MGH 24. GN=L370_01476 OC=Enterobacteriaceae; Enterobacter; Enterobacter cloacae complex.
Sequence
MMHSAAQVNLRPNNRLSDMQAIMEQTQAFENRVLERLNAGKTVRSFLIAAVELLTEAVNI
LVLQVFRKDDYAVKYAVEPLLDGDGPLGDLSVRLKLIYGLGVLNRQEYEDAELLMALREE
LNHDGNEYTFTDDEILGPFGELHCVTALPPAPHFDNSDPELYAMQKLRYQQVVRSTMVLS
LTELISRISLKKAFQK
Download sequence
Identical sequences A0A0G3PFM1 A0A156J0T2 V3PW23
WP_023309920.1.14619 WP_023309920.1.15360 WP_023309920.1.2065 WP_023309920.1.219 WP_023309920.1.22178 WP_023309920.1.22921 WP_023309920.1.23785 WP_023309920.1.24603 WP_023309920.1.35454 WP_023309920.1.3683 WP_023309920.1.37585 WP_023309920.1.43735 WP_023309920.1.44834 WP_023309920.1.45230 WP_023309920.1.47232 WP_023309920.1.48861 WP_023309920.1.49555 WP_023309920.1.5482 WP_023309920.1.55669 WP_023309920.1.61192 WP_023309920.1.61305 WP_023309920.1.6296 WP_023309920.1.7202 WP_023309920.1.75763 WP_023309920.1.75846 WP_023309920.1.83860 WP_023309920.1.86654 WP_023309920.1.9042 WP_023309920.1.92822 WP_023309920.1.93726 WP_023309920.1.94420 WP_023309920.1.98949 WP_023309920.1.99235

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]