SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V4ADI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V4ADI6
Domain Number - Region: 132-207
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0314
Family Capz alpha-1 subunit 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4ADI6
Sequence length 216
Comment (tr|V4ADI6|V4ADI6_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO94907.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_144812 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MATSWSTAVPDFVERKGSMFLRSNHMNYARATLTSNWYVDSREAEPKNYDINRDPTRDLC
KATYDRIGDITDGSLPKTTYQEHSEEIFLKKREFEEKKTTKPMITVENVSNLKIDRDIGS
PNKGYGSVLPRHDPDHNKYYLESTHRADFTPPYPYQPSQVPDLSIAFKKCHSQFTDTSDY
RRNGRNTWQDESGIYNNTHYKRQIYKVADPIPVQLQ
Download sequence
Identical sequences V4ADI6
XP_009054408.1.39240 jgi|Lotgi1|144812|e_gw1.265.6.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]