SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V4AST2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V4AST2
Domain Number - Region: 77-186
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0228
Family Capz alpha-1 subunit 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V4AST2
Sequence length 190
Comment (tr|V4AST2|V4AST2_LOTGI) Uncharacterized protein {ECO:0000313|EMBL:ESO97910.1} KW=Complete proteome; Reference proteome OX=225164 OS=Lottia gigantea (Giant owl limpet). GN=LOTGIDRAFT_153018 OC=Patellogastropoda; Lottioidea; Lottiidae; Lottia.
Sequence
MMMESSINSATILPPYEEEFEPVDNLHWTPETANSIYLFWIHQLQASSGYYRNVGFSSGV
AKTTTLLYAHEVADFLLSIAPRFIKQPRPEEYPNLTTTVRDVDGNNKYIIRYNDGVITRI
QRPDHAGDAYFCGHGKSCDSINVQYVCDKFGRIRHVISGLPGSTHDKIAAEWSPEFMQYI
CTHYRTTSLF
Download sequence
Identical sequences V4AST2
jgi|Lotgi1|153018|fgenesh2_pg.C_sca_2000438 XP_009051750.1.39240

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]