SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V4NS94 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4NS94
Domain Number 1 Region: 43-327
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.15e-82
Family Capz alpha-1 subunit 0.0000196
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V4NS94
Sequence length 338
Comment (tr|V4NS94|V4NS94_EUTSA) Uncharacterized protein {ECO:0000313|EMBL:ESQ49516.1} KW=Complete proteome; Reference proteome OX=72664 OS=Eutrema salsugineum (Saltwater cress) (Sisymbrium salsugineum). GN=EUTSA_v10021069mg OC=Eutrema.
Sequence
MTNLTPFKSTDGDNKLVSPPSSFPRVIEKAMADEEDELPETELSYDQKKEIAKWFLLNAP
AGEINYVAKDLKAVLRDEEVYSEAAMEAFPVYNKSHLICLEMPSRAGDVIVSSYSEITVN
EYLDPRTAQVAIVDHVKQICTKVRPANDEELPSSYIEEYRYALDAEVQRYVSEAYPKGVS
AVNCVKGKDADGPGTDFELVVIISATKLSPQNFCNGSWRSVWNIDFQDESQVLDIKGKLQ
VGAHYFEEGNVELDAKNEFHDSTIFQSADDCAIAIANIIRHHETEYLAALEVAYSKLPDN
TFKDLRRKLPVTRTLFPWQNTLQFSLTREVEKELGLGK
Download sequence
Identical sequences V4NS94
XP_006408063.1.70970 Thhalv10021087m|PACid:20183218

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]