SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V4PCY2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V4PCY2
Domain Number - Region: 33-62
Classification Level Classification E-value
Superfamily Synuclein 0.0471
Family Synuclein 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V4PCY2
Sequence length 62
Comment (tr|V4PCY2|V4PCY2_9CAUL) Uncharacterized protein {ECO:0000313|EMBL:ESQ84994.1} KW=Complete proteome; Reference proteome OX=1121022 OS=Asticcacaulis benevestitus DSM 16100 = ATCC BAA-896. GN=ABENE_19450 OC=Caulobacteraceae; Asticcacaulis.
Sequence
MAIISSAFGGVTLTGSDARKFQDQVTYGRPKSAAIESVKRGVEMAKEYKHTGYVQLKTKP
KK
Download sequence
Identical sequences V4PCY2
WP_018083654.1.24762 WP_018083654.1.94125

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]