SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V4SGA0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4SGA0
Domain Number 1 Region: 10-291
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.24e-79
Family Capz alpha-1 subunit 0.0000153
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V4SGA0
Sequence length 302
Comment (tr|V4SGA0|V4SGA0_9ROSI) Uncharacterized protein {ECO:0000313|EMBL:ESR46653.1} KW=Complete proteome; Reference proteome OX=85681 OS=Citrus clementina. GN=CICLE_v10001982mg OC=Citrus.
Sequence
MAEEVELNPKQKKEIAKWFLLNSPAGEIQYVAKDLRLVLNDNEVYDEAVSESFPIYNKSH
MICLQMPAGAGDVLVTSFGELGENEYLDPRTAQVAIVDHVKQVCTEVRPATDEELSSAYV
EEFRSALDVEILKYAGEAYPKGVCSVYCTKGKEVEGPGFNFELVVVISACRLSPQNFCNG
SWRSVWTIEFQDEAQVLEVKGKLQVGAHYFEEGNVQLDAKHECGDSTLFQSPDDSAISIS
NILRHHETEYLASLEVSYSNLPDNTFKDLRRKLPVTRTLFPWHNTSQFSLTREITKELGI
GK
Download sequence
Identical sequences V4SGA0
XP_006433413.1.91645 XP_006472092.1.29302 clementine0.9_016958m|PACid:19253833

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]