SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V4TDQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V4TDQ6
Domain Number 1 Region: 2-230
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 8.24e-69
Family Capz beta-1 subunit 0.000000658
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V4TDQ6
Sequence length 244
Comment (tr|V4TDQ6|V4TDQ6_9ROSI) Uncharacterized protein {ECO:0000313|EMBL:ESR47796.1} KW=Complete proteome; Reference proteome OX=85681 OS=Citrus clementina. GN=CICLE_v10002214mg OC=Citrus.
Sequence
MEAAMGLMRRMPPKHSETALSALLSLLPDHSSDLLSQVDQPLQVLLDEESGKEFILCEYN
RDADSYRSPWSNKYHPPLEDALYPPAELRKLEIEANEVFAIYRDQYYEGGISSVYMWEDD
NEGFVACFLIKKDGSKTAQGRRGHLEEGAWDAIHVIEVAPEEEGIARYCLTSTVMLSLTT
DHESSGTFSLSGSIRRQMNMDLSVSEGHLCNMGKMIEEMEGKLRNSLDQVSEILVFGGVI
SSES
Download sequence
Identical sequences V4TDQ6
XP_006434556.1.91645 clementine0.9_019989m|PACid:19273146

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]