SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V5EZQ5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V5EZQ5
Domain Number 1 Region: 3-318
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.31e-65
Family Capz beta-1 subunit 0.00000034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V5EZQ5
Sequence length 322
Comment (tr|V5EZQ5|V5EZQ5_KALBG) F-actin capping protein beta subunit {ECO:0000313|EMBL:EST08384.1} KW=Complete proteome; Reference proteome OX=1365824 OS=brasiliensis). GN=PSEUBRA_SCAF17g04368 OC=Ustilaginomycetes; Ustilaginales; Ustilaginaceae; Kalmanozyma.
Sequence
MTDPLDLSLDLLRRLPPSKVEQNLDSIVKLIPSYADDLYSSVDQPLKVKVDESKQGSGRE
YLCCDYNKDGDSWRSWISDTYHPPIAPDADDTADGEPGTRPSAPLRSLELKANDAFATYA
KLYYDNALSSVYLWDLDSDPSSLSGATVGGTHAPSTFAGVVLLKKTIGDASGNGISGAWD
SIHVFEATERASGSSKSSSTGTGVSASYKLTSTVMLGLVRRDEGDEEPTDLKPSSTKVGT
VEIAGSLTRQSEGDYALPDFVSHVSNVGRMIEDMEAKMRNQLQEVYFGKTRDVVSHLRST
QSLEKERKARDLQKELMGLWKK
Download sequence
Identical sequences V5EZQ5
XP_016293373.1.43040

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]