SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V5GHV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V5GHV2
Domain Number - Region: 9-48
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.068
Family Capz alpha-1 subunit 0.058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V5GHV2
Sequence length 121
Comment (tr|V5GHV2|V5GHV2_IXORI) Putative tick ixostatin {ECO:0000313|EMBL:JAB69825.1} OX=34613 OS=Ixodes ricinus (Common tick). GN= OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MKLAHFIVMVTFTHLSCEVLSVSSANFYGEFESLPQECQNKLKGEMEQRCDEDSFHPQLL
KVSECEFTCGGEHNNGQTILTHGRSFFLRDGTPCGQDKVCMQGICINQCSLSFVKGLKER
K
Download sequence
Identical sequences V5GHV2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]