SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V5GZX6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V5GZX6
Domain Number - Region: 13-40
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0837
Family Capz alpha-1 subunit 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V5GZX6
Sequence length 123
Comment (tr|V5GZX6|V5GZX6_IXORI) Putative 6 {ECO:0000313|EMBL:JAB76230.1} OX=34613 OS=Ixodes ricinus (Common tick). GN= OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
FFIIQTARLIVAMVCVVCNLLNQLPPALISQVWEALRRIVMAGLRLFVINTKHGDLKKVA
VTPRDCTVKCTYKPPGRDTVEVGGFPVLNRKYEDVTLPPGMPCAFGAKCKDGKCFCEFCN
TKK
Download sequence
Identical sequences V5GZX6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]