SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V5HP29 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V5HP29
Domain Number 1 Region: 9-230
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.45e-68
Family Capz alpha-1 subunit 0.000000457
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V5HP29
Sequence length 242
Comment (tr|V5HP29|V5HP29_IXORI) Putative f-actin-capping protein subunit alpha-like isoform 2 apis mellifera {ECO:0000313|EMBL:JAB75548.1} OX=34613 OS=Ixodes ricinus (Common tick). GN= OC=Acari; Parasitiformes; Ixodida; Ixodoidea; Ixodidae; Ixodinae; Ixodes.
Sequence
MASDYDEPISDQEKVRIVSDFILLAPPGEFNEVFNDVRLLLNNDTLLKEGASSAFAQYNK
DQLTPVDLEGSDSKALITHYNDLGEGRFYDTRTRQSFRYDHLRKEASDYQSHPNGPPGQQ
GGDNAGGGGYAEAWRAALEEAWTQYARDHYRHGACAVYDRSTSSQEVTLVACLEDHQFQS
QNFWNGRWRSVWTVNFPTGASSTDVKGLVKVQVHYYEDGNVQLVSSKVVSRLPSRSLVSK
QV
Download sequence
Identical sequences V5HP29

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]