SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V6TTV6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V6TTV6
Domain Number 1 Region: 59-259
Classification Level Classification E-value
Superfamily Proteasome activator 6.8e-45
Family Proteasome activator 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V6TTV6
Sequence length 267
Comment (tr|V6TTV6|V6TTV6_GIAIN) Uncharacterized protein {ECO:0000313|EMBL:ESU42024.1} KW=Complete proteome; Reference proteome OX=5741 OS=Giardia intestinalis (Giardia lamblia). GN=GSB_12062 OC=Eukaryota; Diplomonadida; Hexamitidae; Giardiinae; Giardia.
Sequence
MTCMCQLSTKMKGVQRLEAKDRTNKIREVERMMKEEMRAVQRESEEAIYLKLPSIAISFF
AYQKQTKEYIASLVPQLDERFYSLIRVPAKHTKPKKDEVVQSVLINEAFPIMTNPDIVSN
PVLLFPAEEILELEQNLEAQCRDLATALRSIKRWMAVLGAADNLTVMAEEAIGISMEVIE
TIDTSAMSLRNLFVDYHAKRSRAVCNFQKHGSLDYFQLLVLTDKQMFLSISNFVEEMYDI
VCMCYEILDQNFDKFINPRVSVDRGYH
Download sequence
Identical sequences C6LV19 V6TTV6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]