SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V7BVV9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V7BVV9
Domain Number - Region: 38-104
Classification Level Classification E-value
Superfamily Vanabin-like 0.00745
Family Vanabin-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V7BVV9
Sequence length 108
Comment (tr|V7BVV9|V7BVV9_PHAVU) Uncharacterized protein {ECO:0000313|EMBL:ESW20696.1} KW=Complete proteome; Reference proteome OX=3885 OS=Phaseolus vulgaris (Kidney bean) (French bean). GN=PHAVU_005G007400g OC=Phaseoleae; Phaseolus.
Sequence
MGNTEIKVIGLIITVMILLSFTQAQSNNKIDAGVGCKVKCFLKCNEETFPKPNCISDCES
HCSELLSNTVYNCITSCRLMKSIAINIGAHDLMNNVMNTCMQECGKKL
Download sequence
Identical sequences V7BVV9
XP_007148702.1.22112

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]