SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V7PS91 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V7PS91
Domain Number 1 Region: 5-301
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.49e-76
Family Capz alpha-1 subunit 0.00018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V7PS91
Sequence length 307
Comment (tr|V7PS91|V7PS91_9APIC) Uncharacterized protein {ECO:0000313|EMBL:ETB62511.1} KW=Complete proteome OX=1323249 OS=Plasmodium yoelii 17X. GN=YYC_01073 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MDSLLNEKKKFIRHVLSNAPPGKISDLISNLKTIFGSNAIIQNFIEDIISNYNEDNYILI
PFENNEYIIICKESKSGNLYLHPNLKILANVNHLKRKLIDTTPLVKFDHSDILEKYREVC
NNKLKEYVDIYYKKWNEHQIENYPTVNIGAKHGLNVKCASSVYASECENKYNLFFLICCD
RYYLKNFHASSWRSSWNVNFLEADQEIPLTGTVDIVLTYFEDANINFKTRKVFEKRVSVT
NDIENFASSILSVIRECENDVLYDLNHLIANTSSDLIKNTRKIIPLNGDKFYWMETYQDI
PTQIKLI
Download sequence
Identical sequences V7PS91

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]