SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V7PSA9 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V7PSA9
Domain Number 1 Region: 8-267
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.4e-55
Family Capz beta-1 subunit 0.0000322
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V7PSA9
Sequence length 306
Comment (tr|V7PSA9|V7PSA9_9APIC) Uncharacterized protein {ECO:0000313|EMBL:ETB62379.1} KW=Complete proteome OX=1323249 OS=Plasmodium yoelii 17X. GN=YYC_00965 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MEDTKNNEGKIDAVLNICNILPARLFEETIKILSKIDKNLTNNILINKEGPIKIQFDNKE
KKYFLGNMFNKEKDSYRSPYTNLYYPENFPNSYIPSDPLRSLEILYNEVFDRYRKAYYIN
GLSSVYLWPNPIEDGFVACFMIKKKENYSNNTYIDWEGTHLIQVNITHSIIHYQISTTLN
ISIVQKNETILSASVNKVLENPKKISDINLIKDKYFHIENMGKIIEGIENSLRKSIEYIY
LSKINENLNSLRYNDLLYNNKNYYKIKNLETISDDIKFSKGSIQNELKSKLKKKNINGGT
EYLLNT
Download sequence
Identical sequences A0A077Y7Z5 V7PSA9

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]