SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V7PUG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V7PUG5
Domain Number - Region: 69-113
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0994
Family Capz beta-1 subunit 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V7PUG5
Sequence length 305
Comment (tr|V7PUG5|V7PUG5_9APIC) Uncharacterized protein {ECO:0000313|EMBL:ETB63206.1} KW=Complete proteome OX=1323249 OS=Plasmodium yoelii 17X. GN=YYC_00254 OC=Plasmodiidae; Plasmodium; Plasmodium (Vinckeia).
Sequence
MNDRVCRRFFALRNSLSDKLDDKRNYKFINKKNFDEYCTNDKCSNNIEKINAGCLFLFDA
FFKDSSAFSYYTKNNINIVDYIIIWLSNMLSLIEDKENDSRNFLYNTYINNDKYTNPISG
VENHYSSYKDLIDKKNIMNMDMKIISKLYDAFNTLCMLYIEFDEDSPNCKKYLNYANEFD
EKYKKLNKDPSITGNNSYNQLLCTLSTDYDNFKNKYSNVQSCKSSPFPTIEKCVQSSEVT
SAQTFEVASSSSTIGNKLFIVLSIFSAIGFFLGISYKYSLFGFRKRFKKQQIREKIKNIK
KRMNH
Download sequence
Identical sequences V7PUG5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]