SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V8CGI6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V8CGI6
Domain Number - Region: 12-64
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0706
Family Capz beta-1 subunit 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V8CGI6
Sequence length 139
Comment (tr|V8CGI6|V8CGI6_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:ETD26115.1} KW=Complete proteome OX=1073376 OS=Ruminococcus lactaris CC59_002D. GN=HMPREF1202_00166 OC=Ruminococcus.
Sequence
MSDYKEILTSDRVYKKYKSIIPDTNVSIDDIIQKLSYFYKISKDTSEKGKKILEYYNEVG
SVYSIEPPIPQDLMKVMNVPVTLMYVNPATNQFILSGQSEKFTEKITAEIVLLRGLTKAE
HNSKELVFHYVDTINHYYN
Download sequence
Identical sequences B5CKT7 V8CGI6
WP_005609497.1.22275 WP_005609497.1.60390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]