SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V8N3C5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V8N3C5
Domain Number 1 Region: 6-63
Classification Level Classification E-value
Superfamily DEATH domain 0.000000000271
Family Pyrin domain, PYD 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V8N3C5
Sequence length 66
Comment (tr|V8N3C5|V8N3C5_OPHHA) Uncharacterized protein {ECO:0000313|EMBL:ETE56391.1} KW=Complete proteome; Reference proteome OX=8665 OS=Ophiophagus hannah (King cobra) (Naja hannah). GN=L345_17898 OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Ophiophagus.
Sequence
MNSTESDHLYIALNNLFENQFEEFKWRLKSINHNGKENIPIALLVKAKRPEVVDFLIQYY
EEDAVD
Download sequence
Identical sequences V8N3C5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]