SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V8N3Y4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V8N3Y4
Domain Number 1 Region: 33-72
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00000000000314
Family Capz beta-1 subunit 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V8N3Y4
Sequence length 72
Comment (tr|V8N3Y4|V8N3Y4_OPHHA) Uncharacterized protein {ECO:0000313|EMBL:ETE56591.1} KW=Complete proteome; Reference proteome OX=8665 OS=Ophiophagus hannah (King cobra) (Naja hannah). GN=L345_17698 OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Ophiophagus.
Sequence
MEKAGSPADLLHCFCWMGQRWVEIISPTQECCVPSLCEDLLSSVDQPLKIARDKVVGKDY
LLCDYNRDGDSY
Download sequence
Identical sequences V8N3Y4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]