SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V8N4D1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  V8N4D1
Domain Number - Region: 178-205
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0254
Family Capz alpha-1 subunit 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V8N4D1
Sequence length 262
Comment (tr|V8N4D1|V8N4D1_OPHHA) Zinc finger CCCH domain-containing protein 13 {ECO:0000313|EMBL:ETE57144.1} KW=Complete proteome; Reference proteome OX=8665 OS=Ophiophagus hannah (King cobra) (Naja hannah). GN=L345_17144 OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Ophiophagus.
Sequence
REEEREEERVEERERKRERGRDRGRERGREREEERERERGGERGGKEKEIERERDRERER
EREKREEERGRESGREREEERKREEERGRDRKRERERKREREEERERKRERKRKEERERK
REGERGRERERERRKKSKGKKEDQKERKKERKACPPSPPKAGNSSIVALLQKASAQMCRE
SCFGRTRRHLPVQHKLFRWNKIIGTLIDRPSPLLLLYRRRITETTPRGQNWWELHPWKLS
RRDWTATCLKWCSKVSCLGGRG
Download sequence
Identical sequences V8N4D1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]