SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for V8NI06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V8NI06
Domain Number 1 Region: 48-92,129-267
Classification Level Classification E-value
Superfamily Proteasome activator 1.83e-73
Family Proteasome activator 0.00000563
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V8NI06
Sequence length 274
Comment (tr|V8NI06|V8NI06_OPHHA) Proteasome activator complex subunit 3 {ECO:0000313|EMBL:ETE61710.1} KW=Complete proteome; Reference proteome OX=8665 OS=Ophiophagus hannah (King cobra) (Naja hannah). GN=L345_12539 OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Ophiophagus.
Sequence
VRFSLPAVTKPVVFSGGRSRGIKGNRSGLGNRLPCPAMASLLKVDPEVKIKAEDLVANFF
PKKLLELDGFLKDPILNIHDLTQIHSDMNLPVPDPILLTNSHDGLDGVRLSNMKKRKLED
CEETFQGRFCSNQQLVDIIEKVKPEIRLLIEKCNTVKMWVQLLIPRIEDGNNFGVSIQEE
TVAELRTVESEAASYLDQISRYYITRAKLVSKIAKYPHVEDYRRTVTEMDEKEYISLRLI
ISELRNQYVTLHDMILKNIEKIKRPRSSNAETLY
Download sequence
Identical sequences V8NI06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]