SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V8P9E1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V8P9E1
Domain Number 1 Region: 2-257
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.54e-105
Family Capz alpha-1 subunit 0.000000000537
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) V8P9E1
Sequence length 262
Comment (tr|V8P9E1|V8P9E1_OPHHA) F-actin-capping protein subunit alpha-1 {ECO:0000313|EMBL:ETE70633.1} KW=Complete proteome; Reference proteome OX=8665 OS=Ophiophagus hannah (King cobra) (Naja hannah). GN=L345_03557 OC=Toxicofera; Serpentes; Colubroidea; Elapidae; Elapinae; Ophiophagus.
Sequence
VRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMDQFTPVKIEGYDDQ
VLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEDIDTSLKSWRDACDNALRAYVY
SKTIDGQPTVIACIESHQFQPKNFWNGRWRSEWKFTITPPTAQVIAVLKIQVHYYEDGNV
QLVSHKDIQESVAVLNDVQTAKEFIKIIEQAENEYQTAISENYQTMSDTTFKALRRQLPV
TRTKIDWNKILSYKIGKEMQNA
Download sequence
Identical sequences V8P9E1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]