SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9D2R6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9D2R6
Domain Number 1 Region: 7-272
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 4.84e-70
Family Capz alpha-1 subunit 0.00000768
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V9D2R6
Sequence length 282
Comment (tr|V9D2R6|V9D2R6_9EURO) Uncharacterized protein {ECO:0000313|EMBL:ETI20583.1} KW=Complete proteome OX=1279043 OS=Cladophialophora carrionii CBS 160.54. GN=G647_08621 OC=Cladophialophora.
Sequence
MGSTGNTTSSFIEGAPPGEIQDVVKDIKILASDDDPALIAKLKPAFEKYNEDQMVAVKLP
GASDYVLISSHNKLPPSGQSQYYDSASSTSFSFDHTSQKPSSPQSYTHDTQHSSLISSLL
KLLAAHVAEHYPPTSSPSAYTVCATPDDSKVAILISSLKASPKNFLSGRWRTSFLYDPSA
NTLSGEIKVNVHYYEDGNVALATSKSFSDVSVEGSGNADSVIRKLAAIEKQYQEEVNRTI
VGMNETSFKALRRQLPVTRQKVEWEKIRGYGLGGDLRGEGKR
Download sequence
Identical sequences V9D2R6
XP_008731151.1.97232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]