SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9E0W5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9E0W5
Domain Number 1 Region: 11-275
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.67e-69
Family Capz alpha-1 subunit 0.0000361
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) V9E0W5
Sequence length 288
Comment (tr|V9E0W5|V9E0W5_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETI32586.1} KW=Complete proteome; Reference proteome OX=1317065 OS=Phytophthora parasitica P1569. GN=F443_20623 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MAEEWAYEEASDEEKLQIAQRFLLASPPGQIHEVLRDVAKLVPAHVLPDAALRGALHAYN
VKNCLPVDVPDADYKILICEEGEVDAAHYVDPIGNRVLGFDHIKQQIVAEDVAEIPEDRV
TDFEKERQEVQKTLQSYLQFEYMHGGTAGVYIVGTKLVVNLCTERINLRNFWGGRWNSRW
EVDLTANPAKVKGTIQLHVHYFENGNLQLQNSKDIEEEITVQRPGGLGDAILRVMKEAED
DLQTNLEDMYINMSEETFKEMRRVMPVTQTKMEWSLHAHRTAKDLGRK
Download sequence
Identical sequences V9E0W5 W2K5F4 W2QUN6
XP_008897903.1.635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]