SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9F582 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9F582
Domain Number 1 Region: 10-259
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.66e-74
Family Capz beta-1 subunit 0.000000321
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V9F582
Sequence length 287
Comment (tr|V9F582|V9F582_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETI46700.1} KW=Complete proteome; Reference proteome OX=1317065 OS=Phytophthora parasitica P1569. GN=F443_08944 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MSADASGDGGMTSCLNLMRRMPPREVETDVYNLTRLVPSIADDLYQRVDQPLQVAVDPAN
GRKYLLCDYNRDGDSYRSPWTNQYDPPAADGEGFYPSETLRELEIQANEIFDSYRELYYQ
GGISSVYMWDLEPGFAACFLVKKDVVDQRFVEKGGWNSIHVIEVQEGSDVLDKGVKKATY
RLTTSVLLSMKVNRPELGDLTLDGTLTRQAERTMEFEDQFAHVSNMGRMVEDMEIDMRSS
LDGLYISKTREVINGMRKLQQGPAMANPFVGELNSAVLKHGQKKQQE
Download sequence
Identical sequences A0A081A930 A0A0W8CWD8 V9F582 W2GWF7 W2Q624 W2ZC25
XP_008905840.1.635

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]