SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for V9ID06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  V9ID06
Domain Number 1 Region: 3-168
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 5.36e-67
Family Capz alpha-1 subunit 0.0000013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) V9ID06
Sequence length 173
Comment (tr|V9ID06|V9ID06_APICE) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:AEY58346.1} OX=7461 OS=Apis cerana (Indian honeybee). GN=ACCB00887 OC=Apoidea; Apidae; Apis.
Sequence
MAEPWRSALQDEITTYTQSHYRHGACSVFGKSQGGNITLTACIEDHQFQPKNFWNGRWRS
VWTVSFSPSSGNAELRGSLKVQVHYYEDGNVQLVSSKEVKESLPISSEKQTAKELIRLVE
ESENDYQTAISENYQTMSDTTFKALRRQLPVMRTKIDWNKIVSYSIGKELKSQ
Download sequence
Identical sequences V9ID06

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]