SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W0EMK4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W0EMK4
Domain Number - Region: 226-296
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00419
Family Capz alpha-1 subunit 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W0EMK4
Sequence length 372
Comment (tr|W0EMK4|W0EMK4_9BACT) Uncharacterized protein {ECO:0000313|EMBL:AHF12075.1} KW=Complete proteome; Reference proteome OX=880074 OS=Barnesiella viscericola DSM 18177. GN=BARVI_03810 OC=Barnesiella.
Sequence
MSEHIDFISEEQNEEFSNDDLFNITSWGADPSVRELIQQYKEGDIEKPELQRKYVWKKKD
ASRFIESLLLGLPVPSIFLANIEQSGKRLIIDGYQRIRTLYDYIEDGIWHGDDSDFKLIN
SELINERWRGKAFKELTEIDKRRLKNYTIHAIVFEQKHPSDDSGLFQVFERINTSGTTLN
NQEIRNCVYQGNMNTLLFKVNKYQQWRYLYGEQEEDPRMMDLELILRYYALNSVEIYNSD
KKKISLKQTLNKYMQSNINASTDFIAEKESEFYSVIDFIYTNMGEEAFFNLQNDLSKIRR
RLYPTVFDSIMIATSIALKKGCIDVVKNLPEKRLALLRDATYRESISQGTMKIDNIRTRI
SCALHFLYGIKL
Download sequence
Identical sequences A0A0B2JGR6 W0EMK4
WP_025277926.1.34142 WP_025277926.1.69202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]