SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W0TAV8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W0TAV8
Domain Number - Region: 12-65
Classification Level Classification E-value
Superfamily CdCA1 repeat-like 0.00824
Family CdCA1 repeat-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W0TAV8
Sequence length 83
Comment (tr|W0TAV8|W0TAV8_KLUMA) Uncharacterized protein {ECO:0000313|EMBL:BAO40173.1} KW=Complete proteome; Reference proteome OX=1003335 OS=Kluyveromyces marxianus DMKU3-1042. GN=KLMA_40149 OC=Saccharomycetes; Saccharomycetales; Saccharomycetaceae; Kluyveromyces.
Sequence
MFFTRALRSSATIAINHAAQTSAKTAAKSGRHIGEAWAVTEAKRLVPTLGLYATFIATVL
GWPLLYRKVDLGIGINGLEAPKH
Download sequence
Identical sequences W0TAV8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]