SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W1I5E3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W1I5E3
Domain Number - Region: 55-155
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0204
Family Capz alpha-1 subunit 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W1I5E3
Sequence length 368
Comment (tr|W1I5E3|W1I5E3_9BACT) Uncultured bacterium extrachromosomal DNA RGI00802 {ECO:0000313|EMBL:CDL66219.1} OX=77133 OS=uncultured bacterium. GN= OC=Bacteria; environmental samples.
Sequence
MYSIIRKQSHKKTAIQAVHNHNMRIVIEENVNSKKSNLNEILIGTENTRSDIMSYIKNND
IVIRNKDTVIFNEFILTASPEFFFNNKDGSKKSRSEYKSNLKDWVKTQIEFLEKENYGKC
VNAVLHLDESTPHIHALILPIVDNKLNNKSFWRGKNSYGRLQDIYNTANSKFGLKRGEEK
SKTLVDHTTLKDYRDLIRQDKDEENEFYNELSKNILDTPPRKNFIGLEKKYSAEEVKEIA
SATFKKLNRQRRRAKFRAKKSDEKAEAATSEFYKKKKETSKIEFFYNQNMQQLEKTSVEN
STLKTQNLELKQSQSDLDLVRKFLPMELQSLVIRARELASGGDSGGTKHTAEPTPTADLT
TYKRPKYK
Download sequence
Identical sequences W1I5E3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]