SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W1QAQ0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W1QAQ0
Domain Number 1 Region: 2-276
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.31e-79
Family Capz beta-1 subunit 0.000000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W1QAQ0
Sequence length 279
Comment (tr|W1QAQ0|W1QAQ0_OGAPD) F-actin-capping protein subunit beta {ECO:0000313|EMBL:ESW97474.1} KW=Complete proteome; Reference proteome OX=871575 OS=NRRL Y-7560 / DL-1) (Yeast) (Hansenula polymorpha). GN=HPODL_05298 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Ogataea.
Sequence
MSEEKLDASLDLLRRLDPKNISKNLDNICRLQPDLAEDLLSSVDTPLKTARCEESGKTYL
CCDYNRDGDSYRSPWSNVFYPKINDEDEAPHPSSHLRELEIFANKSFDIYRELYYEGGIS
SVYFWDSEEEDVDASGTIGFAGVVLLKKTIDTVNPKDGGSWDSIHVFEVLPGANQKATYK
VTSTVILDISNSDDLNIYLSGNLTRQTSKELQFKDSASHVSNLGSLVEDIESRLRNLLQE
VYFGKTKDILGDIRSLDPLESKSNEREKQAELINNLKNM
Download sequence
Identical sequences W1QAQ0
XP_013933559.1.10505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]