SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W1QDH2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W1QDH2
Domain Number 1 Region: 2-146
Classification Level Classification E-value
Superfamily Arp2/3 complex 16 kDa subunit ARPC5 1.01e-33
Family Arp2/3 complex 16 kDa subunit ARPC5 0.00089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W1QDH2
Sequence length 149
Comment (tr|W1QDH2|W1QDH2_OGAPD) Actin-related protein 2/3 complex subunit 5 {ECO:0000256|RuleBase:RU004301} KW=Complete proteome; Reference proteome OX=871575 OS=NRRL Y-7560 / DL-1) (Yeast) (Hansenula polymorpha). GN=HPODL_05196 OC=Saccharomycetes; Saccharomycetales; Pichiaceae; Ogataea.
Sequence
MEDWRRIDVDQYDPDLQYEPDPIDVPAYSAQQLDSLVTEIRSSVSRGDALGAIKLCVAQP
PYGSDSAIKTTYLQAVLNAFISVRQSEIPNIVKSLDMDETDTLVKLLYSLMSIKEGQKSG
GVLLGWFDKVVEIVGERPIVSYVNSSLTL
Download sequence
Identical sequences W1QDH2
XP_013935190.1.10505

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]