SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W1USG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W1USG5
Domain Number - Region: 39-65
Classification Level Classification E-value
Superfamily DNA polymerase III psi subunit 0.051
Family DNA polymerase III psi subunit 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W1USG5
Sequence length 97
Comment (tr|W1USG5|W1USG5_9STRE) Uncharacterized protein {ECO:0000313|EMBL:ETI94583.1} KW=Complete proteome OX=1403937 OS=Streptococcus sp. DORA_10. GN=Q617_SPSC00268G0004 OC=Streptococcus.
Sequence
MTRKELYENKLQMDYFSDDYIRFEEDFQKYSAMNVPLTFLIDDILRTMAMNQKNYFVLNK
ENAKDGREHSFYFRVVTEKACPRNRTYTYSGVKNSSQ
Download sequence
Identical sequences V8I3I9 W1USG5
WP_023945290.1.84290

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]