SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W2J0Y8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W2J0Y8
Domain Number 1 Region: 10-259
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.09e-74
Family Capz beta-1 subunit 0.000000334
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W2J0Y8
Sequence length 287
Comment (tr|W2J0Y8|W2J0Y8_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETL40036.1} KW=Complete proteome OX=4792 OS=Phytophthora parasitica (Potato buckeye rot agent). GN=L916_08701 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MSADASGDGGMTSCLNLMRRMPPREVETDVYNLTRLVPSIADDLYQRVDQPLQVAVDPAN
GRKYLLCDYNRDGDSYRSPWTNQYDPPAADGEGFYPSETLRELEIQANEIFDSYRELYYQ
GGISSVYMWDLEPGFAACFLVKKDVVDQRFVEKGEWNSIHVIEVQEGSDVLDKGVKKATY
RLTTSVLLSMKVNRPELGDLTLDGTLTRQAERTMEFEDQFAHVSNMGRMVEDMEIDMRSS
LDGLYISKTREVINGMRKLQQGPAMANPFVGELNSAVLKHGQKKQQE
Download sequence
Identical sequences W2J0Y8 W2X110

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]