SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W2T5P1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W2T5P1
Domain Number - Region: 7-36
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0366
Family Capz alpha-1 subunit 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W2T5P1
Sequence length 68
Comment (tr|W2T5P1|W2T5P1_NECAM) Uncharacterized protein {ECO:0000313|EMBL:ETN76267.1} KW=Complete proteome; Reference proteome OX=51031 OS=Necator americanus (Human hookworm). GN=NECAME_11773 OC=Necator.
Sequence
MGKVPSGITSGNNLWVGSWNTCRKIQVVKNTQGQLWSGQYCLAHLEAYEKNNPLKALDKK
GPLDAYCL
Download sequence
Identical sequences W2T5P1
XP_013298494.1.49812

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]