SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W2VYH1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W2VYH1
Domain Number 1 Region: 11-275
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 2.88e-69
Family Capz alpha-1 subunit 0.0000361
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W2VYH1
Sequence length 288
Comment (tr|W2VYH1|W2VYH1_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETP02424.1} KW=Complete proteome OX=1317063 OS=Phytophthora parasitica CJ01A1. GN=F441_20493 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MAEEWAYEEASDEEKLQIAQRFLLASPPGQIHEVLRDVAKLVPAHVLPDAALRGALHAYN
VKNCLPVDVPDADYKILICEEGEVDAAHYVDPISNRVLGFDHIKQQIVAEDVAEIPEDRV
TDFEKERQEVQKTLQSYLQFEYMHGGTAGVYIVGTKLVVNLCTERINLRNFWGGRWNSRW
EVDLTANPAKVKGTIQLHVHYFENGNLQLQNSKDIEEEITVQRPGGLGDAILRVMKEAED
DLQTNLEDMYINMSEETFKEMRRVMPVTQTKMEWSLHAHRTAKDLGRK
Download sequence
Identical sequences W2HWP2 W2VYH1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]