SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W2Y646 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W2Y646
Domain Number 1 Region: 11-275
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 1.44e-68
Family Capz alpha-1 subunit 0.0000429
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W2Y646
Sequence length 288
Comment (tr|W2Y646|W2Y646_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETP30585.1} KW=Complete proteome OX=1317064 OS=Phytophthora parasitica P10297. GN=F442_20430 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MAEEWAYEEASDEEKLQIAQRFLLASPPGQIHEVLRDVAKLVPAHVLPDAALRGALHAYN
VKNCLPVDVPDADYKILICEEGEVDAAHYVDPIGNRVLGFDHIKQQIVAEDVAEIPEDRV
TDFEKERQEVQKTLQSYLQFEYMHGGTAGVYIVGTKLVVNLCTERINLRNFWGGRWNSRW
EVDLTANPSKVKGTIQLHVHYFENGNLQLQNSKDIEEEITVQRSGGLGDAILRVMKEAED
DLQTNLEDMYINMSEETFKEMRRVMPVTQTKMEWSLHAHRTAKDLGRK
Download sequence
Identical sequences W2Y646

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]