SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W2ZYT0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W2ZYT0
Domain Number - Region: 5-61
Classification Level Classification E-value
Superfamily MukF C-terminal domain-like 0.0589
Family MukF C-terminal domain-like 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) W2ZYT0
Sequence length 75
Comment (tr|W2ZYT0|W2ZYT0_PHYPR) Uncharacterized protein {ECO:0000313|EMBL:ETP51409.1} KW=Complete proteome OX=1317064 OS=Phytophthora parasitica P10297. GN=F442_03458 OC=Eukaryota; Stramenopiles; Oomycetes; Peronosporales; Phytophthora.
Sequence
MKMLGTVRISLQVKWIRPALDAAKARMDEAPRGSWDASSEVMIPKPFSCAMILPRFDARQ
ESKYYIARHSKSLQL
Download sequence
Identical sequences W2ZYT0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]