SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W3ASG7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W3ASG7
Domain Number - Region: 105-151
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0915
Family Capz alpha-1 subunit 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W3ASG7
Sequence length 176
Comment (tr|W3ASG7|W3ASG7_9FIRM) Uncharacterized protein {ECO:0000313|EMBL:ETP73758.1} KW=Complete proteome; Reference proteome OX=1165092 OS=Lachnospiraceae bacterium JC7. GN=UYO_0012 OC=Bacteria; Firmicutes; Clostridia; Clostridiales; Lachnospiraceae.
Sequence
MVLCLVCTIITLGIKIVLKNKLASYEAGAASTVVQAETAEQFIVATVGEETDESDEDLIR
KYDMHFKEIDALYGRMTERGQDEGMKDDYRKISELWDRELKALSDDISSRMNEDEKKAFF
DAENNFLVSRNHECMKAVGHNKVSFMEEIDYLDRYTRLTREHCNDLVKDYSSYLAS
Download sequence
Identical sequences W3ASG7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]