SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for W3V7K6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W3V7K6
Domain Number - Region: 19-52
Classification Level Classification E-value
Superfamily Hypothetical protein MTH677 0.0497
Family Hypothetical protein MTH677 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W3V7K6
Sequence length 109
Comment (tr|W3V7K6|W3V7K6_PHOTE) Uncharacterized protein {ECO:0000313|EMBL:ETS31080.1} KW=Complete proteome OX=1004151 OS=Photorhabdus temperata subsp. khanii NC19. GN=PTE_03031 OC=Morganellaceae; Photorhabdus.
Sequence
MNFDKLSPESQKQARLALITILAQMVPDGLSDLDAVFVGEAVAAAFTAMERYSSVSDECK
DESENCDREAFLEAVNTPHPNGKWGGFIEQEKKRQELMLRVAKECESSQ
Download sequence
Identical sequences W3V7K6
WP_070974705.1.40215 WP_070974705.1.85560

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]