SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W3WW42 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W3WW42
Domain Number 1 Region: 5-263
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 3.01e-85
Family Capz alpha-1 subunit 0.00000371
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W3WW42
Sequence length 272
Comment (tr|W3WW42|W3WW42_PESFW) F-actin-capping protein subunit alpha {ECO:0000313|EMBL:ETS78034.1} KW=Complete proteome; Reference proteome OX=1229662 OS=Pestalotiopsis fici (strain W106-1 / CGMCC3.15140). GN=PFICI_10096 OC=Pestalotiopsis.
Sequence
MSNLSTVESFVDGAPPGELADVIADIKSLTVSDPGLVSKLGPAFEKYNEEQFATVKLPGS
SQQVIISSHSSLGDGRYYDVESSSSFSFDHATQKASGAQSHVLEGSQTDLVKSILKSIST
YVSEHYPNAAYGAYPIENDSKVAIIIVSNKYSPNNFWNGRWRSLYIFDPSSGTLEGSIKV
DVHYYEDGNVRLLTNKSSTASISSGTGAGIAKEISANEKKYQEELNRGFTSLSEGAFKSL
RRQLPVTRQKIEWDKVASYRVGQDIGGGSSRR
Download sequence
Identical sequences W3WW42
XP_007836868.1.2009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]