SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W3XPT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  W3XPT4
Domain Number 1 Region: 4-277
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 6.28e-80
Family Capz beta-1 subunit 0.000000133
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W3XPT4
Sequence length 283
Comment (tr|W3XPT4|W3XPT4_PESFW) F-actin-capping protein subunit beta {ECO:0000313|EMBL:ETS87241.1} KW=Complete proteome; Reference proteome OX=1229662 OS=Pestalotiopsis fici (strain W106-1 / CGMCC3.15140). GN=PFICI_01069 OC=Pestalotiopsis.
Sequence
MAADPFDSALDLLRRLNPKHTTQHLQSLISLAPDLTEDLLSSVDQPLTIRRCKQTGRDYL
LCDYNRDGDSYRSPWSNEFDPPLDGGVGDGGAGDGAGAAGVPSDKVRRMEVKANEAFDVY
RELYYEGGVSSVYFWNLDDGFAGVVLLKKEAKPGSTSEGSWDSIHVFEAIDRARVTQYNL
TSTVILSLANSGSGLGDMDLSGNMTRQVETELPAENDEQQIANIGKLVEDMELKMRNLLQ
EVYFGKAKDVVGDLRSIGTLSEAGRDRQAQREIIGSMNKFSRD
Download sequence
Identical sequences W3XPT4
XP_007827841.1.2009

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]