SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W4ID56 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W4ID56
Domain Number - Region: 226-314
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.0144
Family Capz alpha-1 subunit 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) W4ID56
Sequence length 415
Comment (tr|W4ID56|W4ID56_PLAFA) Uncharacterized protein {ECO:0000313|EMBL:ETW40974.1} KW=Complete proteome OX=1036726 OS=Plasmodium falciparum NF135/5.C10. GN=PFNF135_04611 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MFKDQNIHRKDDDYEKNEDIHSNSHSDKNSNINFIFPEKILHKVKEEYFVKHSINESKII
GFYLLNNACVIKYIGNKKNDINNPFLSNVLLKSVLGFCILHGFTKLKVEAESINYESGIK
NKFVEILLNGYTEYEYLGLTLMNVARFSKDLYYIITGYTSKSDLLLSAVMKFEKNFNIYH
NIENNFLKYMNKKSMNLLHELTFNCNDDYYPYKNCYDLYPLVRKNIKNICNFETNSIYKE
LNLLFPDVCKIGKKIALCYEQIKKYIVCSKNSQGCKYYKFIINTFIKPRRKTSFFINHNI
NVQEYLSKKAYTYYLLLCELIKNKEKQLKQEEGQNKNQNVDHAHTYFLLNNIIQYSTFFL
FWNFSTEFWKRFQYIHNNDIHNINEISYQNNNLLFCPMAYAYEFIYHLNVFYINE
Download sequence
Identical sequences A0A024X3E7 W4ID56

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]