SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for W4IZT4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  W4IZT4
Domain Number - Region: 41-109
Classification Level Classification E-value
Superfamily Subunits of heterodimeric actin filament capping protein Capz 0.00497
Family Capz alpha-1 subunit 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) W4IZT4
Sequence length 141
Comment (tr|W4IZT4|W4IZT4_PLAFP) Uncharacterized protein {ECO:0000313|EMBL:ETW55470.1} KW=Complete proteome; Reference proteome OX=57270 OS=Plasmodium falciparum (isolate Palo Alto / Uganda). GN=PFUGPA_02629 OC=Plasmodiidae; Plasmodium; Plasmodium (Laverania).
Sequence
MLKKDLFLFFLFFCFFLQQKNILCSYKECSLLTDDIRILSYCKNESKCFIKNFNNSEYSS
ITCICKKYLNESFFAGPDCSIRVPYHYKKKKNLNLKKKKKKKKKKNNEVHNTSWIEDLLK
LNTWKNEENRVGKLCINPQCS
Download sequence
Identical sequences W4IZT4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]